NRK1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14426

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NRK1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: DDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NRK1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NRK1 Antibody [NBP2-14426]

Immunocytochemistry/ Immunofluorescence: NRK1 Antibody [NBP2-14426]

Immunocytochemistry/Immunofluorescence: NRK1 Antibody [NBP2-14426] - Staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NRK1 Antibody [NBP2-14426]

Immunohistochemistry-Paraffin: NRK1 Antibody [NBP2-14426]

Immunohistochemistry-Paraffin: NRK1 Antibody [NBP2-14426] - Staining of human small intestine shows distinct cytoplasmic and membranous positivity in glandular cells.

Applications for NRK1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NRK1

Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM]

Long Name

Nicotinamide riboside kinase 1

Alternate Names

C9orf95, NmR-K 1, NMRK1, NRK 1, RNK 1

Gene Symbol

NMRK1

Additional NRK1 Products

Product Documents for NRK1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NRK1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NRK1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NRK1 Antibody - BSA Free and earn rewards!

Have you used NRK1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies