NRSF Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82399

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Validated:

Western Blot

Cited:

Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all REST/NRSF Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide towards Rest. Peptide sequence ANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NRSF Antibody - BSA Free

Western Blot: NRSF Antibody [NBP1-82399]

Western Blot: NRSF Antibody [NBP1-82399]

Western Blot: NRSF Antibody [NBP1-82399] - Mouse Heart Lysate 1ug/ml Gel Concentration 6-18%
NRSF Antibody - BSA Free

Western Blot: NRSF Antibody - BSA Free [NBP1-82399] -

Expression and distribution of REST after treatment of HGP a Western blotting image of REST in PC12 cells at control and HGP. b Western blotting image of REST in PCNs at control and HGP. c Immunofluorescence staining of REST in PCNs at Day5, Day10 and HGP. Scale bar, 25 μm. d Nuclear fluorescence intensity of REST. e The expression level of REST in cytoplasm and nucleus of PC12 cells under HGP. Data are mean +/- SD. n = 3 independent experiments. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Unpaired t test for (a), (b) and (e). One-way ANOVA for (d) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35850767), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NRSF Antibody - BSA Free

Western Blot: NRSF Antibody - BSA Free [NBP1-82399] -

Expression and distribution of REST after treatment of HGP a Western blotting image of REST in PC12 cells at control and HGP. b Western blotting image of REST in PCNs at control and HGP. c Immunofluorescence staining of REST in PCNs at Day5, Day10 and HGP. Scale bar, 25 μm. d Nuclear fluorescence intensity of REST. e The expression level of REST in cytoplasm and nucleus of PC12 cells under HGP. Data are mean +/- SD. n = 3 independent experiments. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Unpaired t test for (a), (b) and (e). One-way ANOVA for (d) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35850767), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NRSF Antibody - BSA Free

Western Blot: NRSF Antibody - BSA Free [NBP1-82399] -

Expression and distribution of REST after treatment of HGP a Western blotting image of REST in PC12 cells at control and HGP. b Western blotting image of REST in PCNs at control and HGP. c Immunofluorescence staining of REST in PCNs at Day5, Day10 and HGP. Scale bar, 25 μm. d Nuclear fluorescence intensity of REST. e The expression level of REST in cytoplasm and nucleus of PC12 cells under HGP. Data are mean +/- SD. n = 3 independent experiments. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Unpaired t test for (a), (b) and (e). One-way ANOVA for (d) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35850767), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NRSF Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NRSF Antibody - BSA Free [NBP1-82399] -

Expression and distribution of REST after treatment of HGP a Western blotting image of REST in PC12 cells at control and HGP. b Western blotting image of REST in PCNs at control and HGP. c Immunofluorescence staining of REST in PCNs at Day5, Day10 and HGP. Scale bar, 25 μm. d Nuclear fluorescence intensity of REST. e The expression level of REST in cytoplasm and nucleus of PC12 cells under HGP. Data are mean +/- SD. n = 3 independent experiments. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Unpaired t test for (a), (b) and (e). One-way ANOVA for (d) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35850767), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for NRSF Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
Use in Immunohistochemistry-frozen and Immunocytochemistry/Immunofluorescence reported in scientific literature (PMID:31706914).

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: REST/NRSF

REST, which is short for RE1-silencing transcription factor, locks down neuronal genes in other cells by grabbing onto the DNA and cementing in other molecules, an arrangement that stays intact as non-neuronal cells differentiate into liver, muscle, and other tissues. REST uses a different temporary off mechanism to direct neuronal development. REST is a tumor suppressor gene in epithelial cells and has been found to be mutated in 33 percent of colorectal tumors and cell lines studied. Rest could eventually serve as a marker for diagnosing colorectal and other types of cancer.

Long Name

RE1-Silencing Transcription Factor

Alternate Names

NRSF, XBR

Gene Symbol

REST

UniProt

NP_035393 (Mouse)

Additional REST/NRSF Products

Product Documents for NRSF Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NRSF Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NRSF Antibody - BSA Free

Customer Reviews for NRSF Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NRSF Antibody - BSA Free and earn rewards!

Have you used NRSF Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies