NSP 5 alpha 3 alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09409

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NSP 5 alpha 3 alpha Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NSP 5 alpha 3 alpha (NP_690868). Peptide sequence RTPSTKPKQENEGGEKAALESQVRELLAEAKAKDSEINRLRSELKKYKEK

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

87 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NSP 5 alpha 3 alpha Antibody - BSA Free

Western Blot: NSP 5 alpha 3 alpha Antibody [NBP3-09409]

Western Blot: NSP 5 alpha 3 alpha Antibody [NBP3-09409]

Western Blot: NSP 5 alpha 3 alpha Antibody [NBP3-09409] - Western blot analysis of NSP 5 alpha 3 alpha in HepG2 Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

Applications for NSP 5 alpha 3 alpha Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NSP 5 alpha 3 alpha

NSP 5alpha 3alpha is a novel structure protein with potential roles in ribosome biogenesis and rRNA metabolism/processing. NSP5a3a is highly expressed in certain tumor cell lines, and may serve as a good tumor marker. In these cancer lines, NSP5a3a has been shown to interact with the nucleolar apoptosis protein B23 and may be involved in a novel p73 dependent apoptosis mechanism. Therefore, NSP5a3a is expected to become an important potential target for future cancer treatment research.

Alternate Names

cytospin-B, CYTSBcytospin B, FLJ36955, HCMOGT-1, NSP, NSP5, Nuclear structure protein 5, sperm antigen HCMOGT 1, Sperm antigen HCMOGT-1, sperm antigen with calponin homology and coiled coil domains 1, sperm antigen with calponin homology and coiled-coil domains 1cytokinesis and spindle organization B, sperm antigen with calponin-like and coiled coil domains 1, structure protein NSP5a3a, structure protein NSP5a3b, structure protein NSP5b3a, structure protein NSP5b3b

Gene Symbol

SPECC1

Additional NSP 5 alpha 3 alpha Products

Product Documents for NSP 5 alpha 3 alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NSP 5 alpha 3 alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NSP 5 alpha 3 alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NSP 5 alpha 3 alpha Antibody - BSA Free and earn rewards!

Have you used NSP 5 alpha 3 alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies