Nuclear Factor Erythroid 2 Related Factor 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87953

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Nuclear Factor Erythroid 2 Related Factor 1. Peptide sequence: HTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Nuclear Factor Erythroid 2 Related Factor 1 Antibody - BSA Free

Western Blot: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-87953]

Western Blot: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-87953]

Western Blot: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-87953] - WB Suggested Anti-NFE2L1 Antibody. Titration: 1.0 ug/ml. Positive Control: THP-1 Whole Cell
Western Blot: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-87953]

Western Blot: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-87953]

Western Blot: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-87953] - Host: Rabbit. Target Name: NFE2L1. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

Applications for Nuclear Factor Erythroid 2 Related Factor 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nuclear Factor Erythroid 2 Related Factor 1

Nuclear Factor Erythroid 2 Related Factor 1 is a 772 amino acid transcription factor. It interacts with KEAP1 and activates globin gene expression in erythrocytes. It may play a role in hepatits and anemia.

Alternate Names

FLJ00380, HBZ17, LCR-F1, Locus control region-factor 1, NF-E2-related factor 1, NFE2-related factor 1, NRF1TCF11, nuclear factor (erythroid-derived 2)-like 1, nuclear factor erythroid 2-related factor 1, Nuclear factor, erythroid derived 2, like 1, TCF-11, Transcription factor 11, transcription factor 11 (basic leucine zipper type), Transcription factor HBZ17, Transcription factor LCR-F1

Gene Symbol

NFE2L1

Additional Nuclear Factor Erythroid 2 Related Factor 1 Products

Product Documents for Nuclear Factor Erythroid 2 Related Factor 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nuclear Factor Erythroid 2 Related Factor 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nuclear Factor Erythroid 2 Related Factor 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nuclear Factor Erythroid 2 Related Factor 1 Antibody - BSA Free and earn rewards!

Have you used Nuclear Factor Erythroid 2 Related Factor 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...