NUDT16 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85414

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NUDT16 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of NUDT16. Peptide sequence: VLMQMRFDGRLGFPGGFVDAQDSCLEDGLNRELREELGEAMSAFRVERSD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NUDT16 Antibody - BSA Free

Western Blot: NUDT16 Antibody [NBP2-85414]

Western Blot: NUDT16 Antibody [NBP2-85414]

Western Blot: NUDT16 Antibody [NBP2-85414] - WB Suggested Anti-Nudt16 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Small Intestine

Applications for NUDT16 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUDT16

RNA-decapping enzyme that binds specifically to U8 snoRNA. Part of the U8 snoRNP complex that is required forthe accumulation of mature 5.8S and 28S rRNA. Has diphosphatase activity and removes m7G and m227G caps from U8snoRNA. Has broad substrate specificity with manganese or cobalt as cofactor and can act on various RNA species (invitro)

Alternate Names

EC 3.6.1, EC 3.6.1.-, FLJ31265, FLJ34034, FLJ36248, Nucleoside diphosphate-linked moiety X motif 16, nudix (nucleoside diphosphate linked moiety X)-type motif 16, Nudix motif 16, U8 snoRNA-binding protein H29K, U8 snoRNA-decapping enzyme

Gene Symbol

NUDT16

Additional NUDT16 Products

Product Documents for NUDT16 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NUDT16 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NUDT16 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NUDT16 Antibody - BSA Free and earn rewards!

Have you used NUDT16 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies