NUDT16 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94422

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all NUDT16 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 60-130 of human NUDT16 (NP_689608.2). GFVDTQDRSLEDGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLAVEAGATRA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NUDT16 Antibody - Azide and BSA Free

Western Blot: NUDT16 AntibodyAzide and BSA Free [NBP2-94422]

Western Blot: NUDT16 AntibodyAzide and BSA Free [NBP2-94422]

Western Blot: NUDT16 Antibody [NBP2-94422] - Analysis of extracts of various cell lines, using NUDT16 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

Applications for NUDT16 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NUDT16

RNA-decapping enzyme that binds specifically to U8 snoRNA. Part of the U8 snoRNP complex that is required forthe accumulation of mature 5.8S and 28S rRNA. Has diphosphatase activity and removes m7G and m227G caps from U8snoRNA. Has broad substrate specificity with manganese or cobalt as cofactor and can act on various RNA species (invitro)

Alternate Names

EC 3.6.1, EC 3.6.1.-, FLJ31265, FLJ34034, FLJ36248, Nucleoside diphosphate-linked moiety X motif 16, nudix (nucleoside diphosphate linked moiety X)-type motif 16, Nudix motif 16, U8 snoRNA-binding protein H29K, U8 snoRNA-decapping enzyme

Gene Symbol

NUDT16

Additional NUDT16 Products

Product Documents for NUDT16 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NUDT16 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for NUDT16 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NUDT16 Antibody - Azide and BSA Free and earn rewards!

Have you used NUDT16 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies