Recombinant Human Numb GST (N-Term) Protein

Name: Recombinant Human Numb GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00008650-P01
Price: 749 USD
Availability: InStock
Rating: 2 (1 reviews)

Novus Biologicals | Catalog # H00008650-P01

(1)

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

View all Numb Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-135 of Human NUMB

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

40.59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Reviewed Applications

Read 1 review rated 2 using H00008650-P01 in the following applications:

Binding assay/Protein-protein interaction (1 Review)

Scientific Data Images for Recombinant Human Numb GST (N-Term) Protein

SDS-PAGE: Recombinant Human Numb GST (N-Term) Protein [H00008650-P01]

SDS-Page: Recombinant Human Numb Protein [H00008650-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00008650-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Numb

NUMB( AAH33824, 1 a.a. - 136 a.a.) recombinant protein with GST.

Alternate Names

m-numb, mnb, S171

Gene Symbol

NUMB

Additional Numb Products

Product Documents for Recombinant Human Numb GST (N-Term) Protein

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Recombinant Human Numb GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Neural Crest Cell Markers

Notch Pathway

Customer Reviews for Recombinant Human Numb GST (N-Term) Protein (1)

2 out of 5

1 Customer Rating

5 Stars

4 Stars

3 Stars

2 Stars

100%

1 Stars

Have you used Recombinant Human Numb GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review

Showing 1 - 1 of 1 review Showing All

Filter By:

Recombinant Human Numb Protein

Name: Anonymous

Application: Binding assay/Protein-protein interaction

Verified Customer | Posted 02/25/2020

There are no reviews that match your criteria.