NUP155 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87969

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NUP155 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NUP155. Peptide sequence: MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NUP155 Antibody - BSA Free

Western Blot: NUP155 Antibody [NBP2-87969]

Western Blot: NUP155 Antibody [NBP2-87969]

Western Blot: NUP155 Antibody [NBP2-87969] - WB Suggested Anti-NUP155 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysate

Applications for NUP155 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUP155

Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. The protein encoded by this gene does not contain the typical FG repeat sequences found in most vertebrate nucleoporins. Two protein isoforms are encoded by transcript variants of this gene. (provided by RefSeq)

Alternate Names

155 kDa nucleoporin, KIAA0791nucleoporin 155kD, N155, nuclear pore complex protein Nup155, nucleoporin 155kDa, Nucleoporin Nup155

Gene Symbol

NUP155

Additional NUP155 Products

Product Documents for NUP155 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NUP155 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NUP155 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NUP155 Antibody - BSA Free and earn rewards!

Have you used NUP155 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies