NXF5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84196

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NXF5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NXF5. Peptide sequence: FTPVDFHYIRNRACFFVQVASAASALKDVSYKIYDDENQKICIFVSHFTA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NXF5 Antibody - BSA Free

Western Blot: NXF5 Antibody [NBP2-84196]

Western Blot: NXF5 Antibody [NBP2-84196]

Western Blot: NXF5 Antibody [NBP2-84196] - WB Suggested Anti-NXF5 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: COLO205 cell lysate

Applications for NXF5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NXF5

NXF5, also known as Nuclear RNA export factor 5, consists of 6 isoforms ranging from a 168 amino acid isoform that is 20 kDa to a 397 amino acid isoform that is 46 kDa, it is implicated in mRNA nuclear export and could also have a role in polarized cytoplasmic transport and localization of mRNA in neurons. On the other hand, this protein has lost several C-terminal protein domains found in other family members that are required for export activity, and may be an evolving pseudogene. Current research is being performed on several diseases including pelizaeus-merzbacher disease, premature ovarian failure, short stature, intellectual disability, influenza, and neuronitis. The NXF5 has shown an interaction with ALYREF, EIF4A3, NUP98, NUPL2, NXT1, NXT2, RAE1, and THOC5 in ribosome biogenesis in eukaryotes, RNA transport, mRNA surveillance pathway, and influenza A pathways.

Alternate Names

nuclear RNA export factor 5, TAPL1, TAPL-1, TAP-like protein 1

Gene Symbol

NXF5

Additional NXF5 Products

Product Documents for NXF5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NXF5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NXF5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NXF5 Antibody - BSA Free and earn rewards!

Have you used NXF5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies