O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)
Novus Biologicals | Catalog # NBP3-16203
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunoprecipitation, Chromatin Immunoprecipitation (ChIP)
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 3Q9B8 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 947-1046 of human O-GlcNAc Transferase p110 subunit (O15294). PGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)
Western Blot: O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) [NBP3-16203]
Western Blot: O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) [NBP3-16203] - Western blot analysis of extracts of various cell lines, using O-GlcNAc Transferase p110 subunit Rabbit mAb (NBP3-16203) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Chromatin Immunoprecipitation: O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) [NBP3-16203] -
Chromatin Immunoprecipitation: O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) [NBP3-16203] - Chromatin immunoprecipitation analysis of extracts of 293T cells, using O-GlcNAc Transferase p110 subunit Rabbit mAb antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.Applications for O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)
Application
Recommended Usage
Chromatin Immunoprecipitation (ChIP)
1:500 - 1:1000
Immunoprecipitation
1:500 - 1:1000
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: O-GlcNAc Transferase/OGT
Long Name
O-Linked N-Acetylglucosamine (GlcNAc) Transferase
Alternate Names
HRNT1, OGlcNAc Transferase, OGT
Gene Symbol
OGT
Additional O-GlcNAc Transferase/OGT Products
Product Documents for O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)
There are currently no reviews for this product. Be the first to review O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) and earn rewards!
Have you used O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ChIP Protocol Video
- Chromatin Immunoprecipitation (ChIP) Protocol
- Chromatin Immunoprecipitation Protocol
- Immunoprecipitation Protocol
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...