OBCAM/OPCML Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09427

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all OBCAM/OPCML Primary Antibodies »

Product Specifications

Immunogen

The immunogen for Anti-OBCAM/OPCML antibody is: synthetic peptide directed towards the C-terminal of Rat OPCM (NP_446300.1). Peptide sequence EDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNT

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OBCAM/OPCML Antibody - BSA Free

Western Blot: OBCAM/OPCML Antibody [NBP3-09427]

Western Blot: OBCAM/OPCML Antibody [NBP3-09427]

Western Blot: OBCAM/OPCML Antibody [NBP3-09427] - Western blot analysis of OBCAM/OPCML in Rat Liver. Antibody dilution at 1.0ug/ml

Applications for OBCAM/OPCML Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OBCAM/OPCML

OPCML encodes a member of the IgLON subfamily in the immunoglobulin protein superfamily. The encoded protein is localized in the plasma membrane and may have an accessory role in opioid receptor function. This gene has an ortholog in rat and bovine. The opioid binding-cell adhesion molecule encoded by the rat gene binds opioid alkaloids in the presence of acidic lipids, exhibits selectivity for mu ligands and acts as a GPI-anchored protein. Since the encoded protein is highly conserved in species during evolution, it may have a fundamental role in mammalian systems. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Long Name

Opioid-binding Cell Adhesion Molecule/Opioid Binding Protein/Cell Adhesion Molecule-like

Alternate Names

OPCML

Gene Symbol

OPCML

Additional OBCAM/OPCML Products

Product Documents for OBCAM/OPCML Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OBCAM/OPCML Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Immunoglobulin Superfamily CAMs

Customer Reviews for OBCAM/OPCML Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OBCAM/OPCML Antibody - BSA Free and earn rewards!

Have you used OBCAM/OPCML Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies