Catalog Number: 4664
Biological Activity
Highly potent integrin α1β1 inhibitor (IC50 = 0.8 nM for α1β1 binding to type IV collagen). Selective for α1β1 over α2β1, αIIbβ3, αvβ3, α4β1, α5β6, α9β1 and α4β7. Inhibits FGF2-stimulated angiogenesis in the chicken chorioallantoic model. Displays antitumor efficacy in a synergistic mouse model of Lewis lung carcinoma; blocks human melanoma growth in nude mice.
Technical Data
  • M.Wt:
    4393.07
  • Formula:
    C184H284N52O57S8
  • Sequence:
    CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG

    (Modifications: Disulfide bridge: 1 - 10, 6 - 29, 7 - 34, 19 - 36)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Store at -20°C
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Obtustatin: a potent and selective inhibitor of α1β1 integrin in vitro and angiogenesis in vivo.
    Marcinkiewicz et al.
    Cancer Res., 2003;63:2020
  2. Amino acid sequence and homology modeling of obtustatin, a novel non-RGD-containing short disintegrin isolated from the venom of Vipera lebetina obtusa.
    Moreno-Murciano et al.
    Protein Sci., 2003;12:366
  3. Angiostatic activity of obtustatin as α1β1 integrin inhibitor in experimental melanoma growth.
    Brown et al.
    Int.J.Cancer, 2008;123:2195

Have you used Obtustatin?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information