Obtustatin

Catalog # Availability Size / Price Qty
4664/100U
Cat.No. 4664 - Obtustatin | Cys-Thr-Thr-Gly-Pro-Cys-Cys-Arg-Gln-Cys-Lys-Leu-Lys-Pro-Ala-Gly-Thr-Thr-Cys-Trp-Lys-Thr-Ser-Leu-Thr-Ser-His-Tyr-Cys-Thr-Gly-Lys-Ser-Cys-Asp-Cys-Pro-Leu-Tyr-Pro-Gly
1 Image
Description: Potent and selective α1β1 inhibitor
Product Details
Citations (2)
Supplemental Products
Reviews

Biological Activity

Highly potent integrin α1β1 inhibitor (IC50 = 0.8 nM for α1β1 binding to type IV collagen). Selective for α1β1 over α2β1, αIIbβ3, αvβ3, α4β1, α5β6, α9β1 and α4β7. Inhibits FGF2-stimulated angiogenesis in the chicken chorioallantoic model. Displays antitumor efficacy in a synergistic mouse model of Lewis lung carcinoma; blocks human melanoma growth in nude mice.

Technical Data

M.Wt:
4393.07
Formula:
C184H284N52O57S8
Sequence:
CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG

(Modifications: Disulfide bridge: 1 - 10, 6 - 29, 7 - 34, 19 - 36)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.

Product Datasheets

or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Citations for Obtustatin

The citations listed below are publications that use Tocris products. Selected citations for Obtustatin include:

2 Citations: Showing 1 - 2

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Obtustatin

There are currently no reviews for this product. Be the first to review Obtustatin and earn rewards!

Have you used Obtustatin?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.