Obtustatin

  ( 2 citations )    
Product Datasheet
Catalog Number:4664
Chemical Name:
Product Details
Citations (2)
Supplemental Products
Reviews
Biological Activity
Highly potent integrin α1β1 inhibitor (IC50 = 0.8 nM for α1β1 binding to type IV collagen). Selective for α1β1 over α2β1, αIIbβ3, αvβ3, α4β1, α5β6, α9β1 and α4β7. Inhibits FGF2-stimulated angiogenesis in the chicken chorioallantoic model. Displays antitumor efficacy in a synergistic mouse model of Lewis lung carcinoma; blocks human melanoma growth in nude mice.
Technical Data
  • M.Wt:
    4393.07
  • Formula:
    C184H284N52O57S8
  • Sequence:
    CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG

    (Modifications: Disulfide bridge: 1 - 10, 6 - 29, 7 - 34, 19 - 36)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Store at -20°C
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Product Datasheets
COA view current batch
or select another batch:
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Obtustatin include:

2 Citations: Showing 1 - 2
Filter your results:

  1. Collagen Type 1 accelerates healing of ruptured fetal membranes.
    Authors: Mogami
    Sci Rep  2018;8(1):696
  2. Reciprocal signalling by Notch-Collagen V-CALCR retains muscle stem cells in their niche
    Authors: Baghdadi
    Nature  2018;557:714

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs
VersaClone cDNA Plasmids
Description Application Cat# Citations Images  

Have you used Obtustatin?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee