OR2C3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85424

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all OR2C3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human OR2C3. Peptide sequence: LQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKSALRHMVLENC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit OR2C3 Antibody - BSA Free (NBP2-85424) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for OR2C3 Antibody - BSA Free

Western Blot: OR2C3 Antibody [NBP2-85424]

Western Blot: OR2C3 Antibody [NBP2-85424]

Western Blot: OR2C3 Antibody [NBP2-85424] - Host: Rabbit. Target Name: OR2C3. Sample Tissue: Human Stomach Tumor lysates. Antibody Dilution: 1ug/ml

Applications for OR2C3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR2C3

OR2C3, also known as Olfactory receptor 2C3, is a 35.4 kDa, 320 amino acid protein that is utilized in a 7-transmembrane domain structure as an olfactory receptor. Diseases and disorders such as leukemia, lymphoblastic leukemia, and neuronitis are currently being studied with the protein. The protein interacts in GPCR and olfactory signaling pathways with other proteins such as OR1J4, OR5H2, OR10A3, OR52E6, and OR5B2.

Alternate Names

olfactory receptor 2C3, Olfactory receptor 2C4, Olfactory receptor 2C5, Olfactory receptor OR1-30, olfactory receptor, family 2, subfamily C, member 3, olfactory receptor, family 2, subfamily C, member 4, olfactory receptor, family 2, subfamily C, member 5 pseudogene, OR2C4, OR2C5P, OST742

Gene Symbol

OR2C3

Additional OR2C3 Products

Product Documents for OR2C3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR2C3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR2C3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR2C3 Antibody - BSA Free and earn rewards!

Have you used OR2C3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies