OR2D3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69086

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all OR2D3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to OR2D3 (olfactory receptor, family 2, subfamily D, member 3) The peptide sequence was selected form the C terminal of OR2D3. Peptide sequence LKAFSTCGSHLIVVVLFYGSGIFTYMRPNSKTTKELDKMISVFYTAVTPM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for OR2D3 Antibody - BSA Free

Western Blot: OR2D3 Antibody [NBP1-69086]

Western Blot: OR2D3 Antibody [NBP1-69086]

Western Blot: OR2D3 Antibody [NBP1-69086] - Titration: 1.0 ug/ml Positive Control: 293T Whole Cell.

Applications for OR2D3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR2D3

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Alternate Names

olfactory receptor 2D3, Olfactory receptor OR11-89, olfactory receptor, family 2, subfamily D, member 3, OR11-89

Gene Symbol

OR2D3

OMIM

NP_001004684 (Human)

Additional OR2D3 Products

Product Documents for OR2D3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OR2D3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR2D3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR2D3 Antibody - BSA Free and earn rewards!

Have you used OR2D3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies