OR2G2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-11000

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all OR2G2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR2G2 (NP_001001915). Peptide sequence VTIFYGTIIFMYLQPAKSRSRDQGKFVSLFYTVVTRMLNPLIYTLRIKEV

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OR2G2 Antibody - BSA Free

Western Blot: OR2G2 Antibody [NBP3-11000]

Western Blot: OR2G2 Antibody [NBP3-11000]

Western Blot: OR2G2 Antibody [NBP3-11000] - Western blot analysis of OR2G2 in Human Ovary Tumor lysates. Antibody dilution at 1ug/ml

Applications for OR2G2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR2G2

OR2G2, also known as Olfactory receptor 2G2, is a 35.6 kDa, 317 amino acid protein that is involved in olfactory reception as a member of the G-protein-coupled receptor family. Current research is being conducted to study the effects of the protein on diseases and disorders such as toxoplasmosis and neuronitis. The protein interacts in olfactory signaling, GPCR downstream signaling, and signal transduction pathways with OR52E6, OR1C1, OR6F1, OR2G3, and OR14A16.

Alternate Names

olfactory receptor 2G2, Olfactory receptor OR1-32, olfactory receptor, family 2, subfamily G, member 2, olfactory receptor, family 2, subfamily G, member 2 pseudogene, OR1-32

Gene Symbol

OR2G2

Additional OR2G2 Products

Product Documents for OR2G2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR2G2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR2G2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR2G2 Antibody - BSA Free and earn rewards!

Have you used OR2G2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies