OR2W3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83315

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all OR2W3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2W3. Peptide sequence: IIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGALGRL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for OR2W3 Antibody - BSA Free

Western Blot: OR2W3 Antibody [NBP2-83315]

Western Blot: OR2W3 Antibody [NBP2-83315]

Western Blot: OR2W3 Antibody [NBP2-83315] - Host: Rabbit. Target Name: OR2W3. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for OR2W3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR2W3

OR2W3, also known as Olfactory receptor 2W3, is a 34.8 kDa, 314 amino acid protein that is involved in reception and transduction of odor signals as a member of the olfactory receptor gene family. Current research is being conducted to determine the effect of the protein on diseases and disorders such as neuronitis and azoospermia. The protein interacts in signal transduction pathways with OR1A1, OR10G3, OR52E6, OR1A2, and OR5P3.

Alternate Names

olfactory receptor 2W3, Olfactory receptor 2W8, Olfactory receptor OR1-49, olfactory receptor, family 2, subfamily W, member 3, olfactory receptor, family 2, subfamily W, member 3 pseudogene, olfactory receptor, family 2, subfamily W, member 8 pseudogene, OR2W3P, OR2W8P, OST718

Gene Symbol

OR2W3

Additional OR2W3 Products

Product Documents for OR2W3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR2W3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR2W3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR2W3 Antibody - BSA Free and earn rewards!

Have you used OR2W3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies