OR3A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09739

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR3A3 (NP_036505). Peptide sequence MRLGSVESSDKDKGVGVFMTVINPMLNPLIYSLRNTDVQGALCQLLVGKR

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OR3A3 Antibody - BSA Free

Western Blot: OR3A3 Antibody [NBP3-09739]

Western Blot: OR3A3 Antibody [NBP3-09739]

Western Blot: OR3A3 Antibody [NBP3-09739] - Western blot analysis of OR3A3 in Human 293T Whole Cell. Antibody dilution at 1ug/ml

Applications for OR3A3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR3A3

OR3A3, also known as Olfactory receptor 3A3, is a 35 kDa, 321 amino acid protein that is utilized in the nose as an odorant receptor. Diseases such as neuronitis are currently being researched with the protein. The protein interacts with GNAL, ADRBK2, and ARRB2 in GPCR and olfactory signal transduction pathways.

Alternate Names

Olfactory receptor 17-201, olfactory receptor 3A3, Olfactory receptor 3A6, Olfactory receptor 3A7, Olfactory receptor 3A8, Olfactory receptor OR17-22, olfactory receptor, family 3, subfamily A, member 3, olfactory receptor, family 3, subfamily A, member 6, olfactory receptor, family 3, subfamily A, member 7, olfactory receptor, family 3, subfamily A, member 8 pseudogene, OR17-137, OR17-16, OR17-201OR3A6, OR3A7, OR3A8P

Gene Symbol

OR3A3

Additional OR3A3 Products

Product Documents for OR3A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR3A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR3A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR3A3 Antibody - BSA Free and earn rewards!

Have you used OR3A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...