OR4K1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83318

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all OR4K1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4K1. Peptide sequence: PFSRLPVDKFLSVFYTVCTPLLNPIIYSLRNEDVKAAMWKLRNRHVNSWK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for OR4K1 Antibody - BSA Free

Western Blot: OR4K1 Antibody [NBP2-83318]

Western Blot: OR4K1 Antibody [NBP2-83318]

Western Blot: OR4K1 Antibody [NBP2-83318] - Host: Rabbit. Target Name: OR4K1. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for OR4K1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR4K1

OR4K1, also known as Olfactory receptor 4K1, is a 35.2 kDa, 311 amino acid protein that is involved in reception of odorant molecules in the nose as a member of the largest gene family in the genome. The protein is currently being researched for its effects on neuronitis. The protein interacts with OR4K14, OR4K2, OR52E6, OR4K5, and OR4K13 in olfactory transduction and GPCR downstream signaling pathways.

Alternate Names

olfactory receptor 4K1, Olfactory receptor OR14-19, olfactory receptor, family 4, subfamily K, member 1, OR14-19

Gene Symbol

OR4K1

Additional OR4K1 Products

Product Documents for OR4K1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR4K1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR4K1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR4K1 Antibody - BSA Free and earn rewards!

Have you used OR4K1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies