ORC4L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56938

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ORC4L Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ORC4L Antibody - BSA Free

Western Blot: ORC4L Antibody [NBP2-56938]

Western Blot: ORC4L Antibody [NBP2-56938]

Western Blot: ORC4L Antibody [NBP2-56938] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: ORC4L Antibody [NBP2-56938]

Immunocytochemistry/ Immunofluorescence: ORC4L Antibody [NBP2-56938]

Immunocytochemistry/Immunofluorescence: ORC4L Antibody [NBP2-56938] - Staining of human cell line RH-30 shows localization to nucleus & nucleoli.

Applications for ORC4L Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ORC4L

The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. It has been shown to form a core complex with ORC2L, -3L, and -5L. Three alternatively spliced transcript variants encoding the same protein have been reported.

Alternate Names

HsORC4, ORC4LFLJ46668, ORC4P, origin recognition complex subunit 4, origin recognition complex, subunit 4, origin recognition complex, subunit 4 (yeast homolog)-like, origin recognition complex, subunit 4 homolog, origin recognition complex, subunit 4 homolog (S. cerevisiae), origin recognition complex, subunit 4-like, origin recognition complex, subunit 4-like (S. cerevisiae), origin recognition complex, subunit 4-like (yeast)

Gene Symbol

ORC4

Additional ORC4L Products

Product Documents for ORC4L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ORC4L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ORC4L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ORC4L Antibody - BSA Free and earn rewards!

Have you used ORC4L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies