OSBP1 Antibody (5A3) - Azide and BSA Free

Novus Biologicals | Catalog # H00005007-M01-100ug

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 5A3

Format

Azide and BSA Free
View all OSBP1 Primary Antibodies »

Product Specifications

Immunogen

OSBP (NP_002547.1, 324 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GATVLPANTPGNVGSGKDQCCSGKGDMSDEDDENEFFDAPEIITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRT

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for OSBP1 Antibody (5A3) - Azide and BSA Free

Western Blot: OSBP1 Antibody (5A3) [H00005007-M01-100ug]

Western Blot: OSBP1 Antibody (5A3) [H00005007-M01-100ug]

Western Blot: OSBP1 Antibody (5A3) [H00005007-M01-100ug] - Detection against Immunogen (34.98 KDa).
Western Blot: OSBP1 Antibody (5A3) [H00005007-M01-100ug]

Western Blot: OSBP1 Antibody (5A3) [H00005007-M01-100ug]

Western Blot: OSBP1 Antibody (5A3) [H00005007-M01-100ug] - OSBP monoclonal antibody (M01), clone 5A3. Western Blot analysis of OSBP expression in Jurkat.
ELISA: OSBP1 Antibody (5A3) [H00005007-M01-100ug]

ELISA: OSBP1 Antibody (5A3) [H00005007-M01-100ug]

ELISA: OSBP1 Antibody (5A3) [H00005007-M01-100ug] - Detection limit for recombinant GST tagged OSBP is 0.03 ng/ml as a capture antibody.

Applications for OSBP1 Antibody (5A3) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: OSBP1

Oxysterol binding protein is an intracellular protein that is believed to transport sterols from lysosomes to the nucleus where the sterol down-regulates the genes for the LDL receptor, HMG-CoA reductase, and HMG synthetase.

Alternate Names

OSBP1oxysterol-binding protein 1, oxysterol binding protein

Entrez Gene IDs

5007 (Human)

Gene Symbol

OSBP

OMIM

167040 (Human)

UniProt

NP_002547.1 (Human)

Additional OSBP1 Products

Product Documents for OSBP1 Antibody (5A3) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OSBP1 Antibody (5A3) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OSBP1 Antibody (5A3) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review OSBP1 Antibody (5A3) - Azide and BSA Free and earn rewards!

Have you used OSBP1 Antibody (5A3) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies