OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87997

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all OTUD7B/Cezanne Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OTUD7B/Cezanne/ZA20D1. Peptide sequence: WKGGKEEAAGDGPVSEKPPAESVGNGGSKYSQEVMQSLSILRTAMQGEGK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free

Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody [NBP2-87997]

Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody [NBP2-87997]

Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody [NBP2-87997] - WB Suggested Anti-ZA20D1 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:312500. Positive Control: Daudi cell lysateOTUD7B is supported by BioGPS gene expression data to be expressed in Daudi

Applications for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OTUD7B/Cezanne

ZA20D1 has deubiquitinating activity that is directed towards 'Lys-48' or 'Lys-63'-linked polyubiquitin chains.Hydrolyzes both linear and branched forms of polyubiquitin. Negative regulator of nuclear factor NF-kappa-B

Long Name

OTU Domain-containing Protein 7B

Alternate Names

Cezanne, ZA20D1

Gene Symbol

OTUD7B

Additional OTUD7B/Cezanne Products

Product Documents for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free and earn rewards!

Have you used OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Ubiquitination Cascade Pathway Ubiquitination Cascade Pathway Thumbnail