P11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55877

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all P11 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDYEHLCTEDHKESEPLPQLEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for P11 Antibody - BSA Free

Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877]

Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877]

Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877] - Staining of human placenta shows very strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877]

Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877]

Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877]

Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877]

Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877]

Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877]

Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877] - Staining of human esophagus, placenta, skeletal muscle and skin using Anti-ENDOU antibody NBP2-55877 (A) shows similar protein distribution across tissues to independent antibody NBP1-82458 (B).
Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877]

Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877]

Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877]

Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877]

Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877] - Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877]

Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877]

Immunohistochemistry-Paraffin: P11 Antibody [NBP2-55877] - Staining in human esophagus and endometrium tissues using NBP2-55877 antibody. Corresponding ENDOU RNA-seq data are presented for the same tissues.

Applications for P11 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: P11

p11 increases localization of 5-HT1B receptors at the cell surface. It is increased in rodent brains by antidepressants or electroconvulsive therapy, but decreased in an animal model of depression and in brain tissue from depressed patients. Overexpression of p11 increases 5-HT1B receptor function in cells and recapitulates certain behaviors seen after antidepressant treatment in mice. p11 knockout mice exhibit a depression-like phenotype and have reduced responsiveness to 5-HT1B receptor agonists and reduced behavioral reactions to an antidepressant.

Alternate Names

EC 3.1, endonuclease, polyU-specific, MGC133268, P11,26 serine protease, Placental protein 11, poly(U)-specific endoribonuclease, PP1122 serine protease, Protein endoU, PRSS26, Uridylate-specific endoribonuclease

Gene Symbol

ENDOU

Additional P11 Products

Product Documents for P11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for P11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for P11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review P11 Antibody - BSA Free and earn rewards!

Have you used P11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies