p190RhoGAP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49172

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all p190RhoGAP Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LVALTDGAVDVLDNDLSREQLTEGEEIAQEIDGRFTSIPCSQPQHKLEIFHPFFKDVVEKKNIIEATHMYDNAAEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit p190RhoGAP Antibody - BSA Free (NBP2-49172) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for p190RhoGAP Antibody - BSA Free

Western Blot: p190RhoGAP Antibody [NBP2-49172]

Western Blot: p190RhoGAP Antibody [NBP2-49172]

Western Blot: p190RhoGAP Antibody [NBP2-49172] - Analysis in human cell line WM-115.
Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49172]

Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49172]

Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49172] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49172]

Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49172]

Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49172] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49172]

Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49172]

Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49172] - Staining of human testis shows moderate membranous and cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49172]

Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49172]

Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49172] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49172]

Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49172]

Immunohistochemistry-Paraffin: p190RhoGAP Antibody [NBP2-49172] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.

Applications for p190RhoGAP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: p190RhoGAP

The human glucocorticoid receptor DNA binding factor, which associates with the promoter region of the glucocorticoid receptor gene (hGR gene), is a repressor of glucocorticoid receptor transcription. The amino acid sequence deduced from the cDNA sequences show the presence of three sequence motifs characteristic of a zinc finger and one motif suggestive of a leucine zipper in which 1 cysteine is found instead of all leucines. The GRLF1 enhances the homologous down-regulation of wild-type hGR gene expression. Biochemical analysis suggests that GRLF1 interaction is sequence specific and that transcriptional efficacy of GRLF1 is regulated through its interaction with specific sequence motif. The level of expression is regulated by glucocorticoids. [provided by RefSeq]

Alternate Names

glucocorticoid receptor DNA binding factor 1, glucocorticoid receptor DNA-binding factor 1, glucocorticoid receptor repression factor 1, GRF1, GRF-1, GRLF1, KIAA1722, MGC10745, P190A, P190-A, p190ARhoGAP, p190RhoGAP, rho GAP p190A, Rho GTPase activating protein 35, rho GTPase-activating protein 35

Gene Symbol

ARHGAP35

Additional p190RhoGAP Products

Product Documents for p190RhoGAP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for p190RhoGAP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for p190RhoGAP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review p190RhoGAP Antibody - BSA Free and earn rewards!

Have you used p190RhoGAP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies