P2Y12/P2RY12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33870

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Canine, Feline

Cited:

Human, Mouse, Primate - Macaca mulatta (Rhesus Macaque)

Applications

Validated:

Multiplex Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Cited:

Immunohistochemistry, Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all P2Y12/P2RY12 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

Reactivity Notes

Feline, Canine reactivity reported from verified customer reviews.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit P2Y12/P2RY12 Antibody - BSA Free (NBP2-33870) is a polyclonal antibody validated for use in Multiplex Immunofluorescence, IHC, WB, ICC/IF and Simple Western. Anti-P2Y12/P2RY12 Antibody: Cited in 12 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for P2Y12/P2RY12 Antibody - BSA Free

P2Y12/P2RY12 Antibody - BSA Free Detection of P2Y12/P2RY12 in human Brain Cortex via seqIF™ staining on COMET™

Detection of P2Y12/P2RY12 in human Brain Cortex via seqIF™ staining on COMET™

P2Y12/P2RY12 was detected in immersion fixed paraffin-embedded sections of human Cortex using Rabbit Anti-human P2Y12/P2RY12, Polyclonal Antibody (Catalog # NBP2-33870) at 1:100 at 37°Celsius for 4 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH).Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to cell membrane of microglia. Protocol available in COMET™ Panel Builder.

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870]

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870]

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining in human cerebral cortex and liver tissues. Corresponding P2RY12 RNA-seq data are presented for the same tissues.
Western Blot: P2Y12/P2RY12 Antibody [NBP2-33870]

Western Blot: P2Y12/P2RY12 Antibody [NBP2-33870]

P2Y12-P2RY12-Antibody-Western-Blot-NBP2-33870-img0018.jpg
Immunocytochemistry/ Immunofluorescence: P2Y12/P2RY12 Antibody [NBP2-33870]

Immunocytochemistry/ Immunofluorescence: P2Y12/P2RY12 Antibody [NBP2-33870]

Immunocytochemistry/Immunofluorescence: P2Y12/P2RY12 Antibody [NBP2-33870] - Green-P2Y12/P2RY12, Blue-DAPI. 1:200 dilution for fixed tissue sections of feline optical nerve. ICC/IF image submitted by a verified customer review.
Immunohistochemistry: P2Y12/P2RY12 Antibody [NBP2-33870]

Immunohistochemistry: P2Y12/P2RY12 Antibody [NBP2-33870]

P2Y12-P2RY12-Antibody-Immunohistochemistry-NBP2-33870-img0019.jpg
Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870]

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870]

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human cerebral cortex shows strong cytoplasmic positivity in microglia.
Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870]

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870]

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human liver shows no positivity as expected.
Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870]

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870]

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870]

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870]

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human cerebellum shows strong cytoplasmic positivity in microglia.
Immunohistochemistry-Frozen: P2Y12/P2RY12 Antibody [NBP2-33870]

Immunohistochemistry-Frozen: P2Y12/P2RY12 Antibody [NBP2-33870]

Immunohistochemistry-Frozen: P2Y12/P2RY12 Antibody [NBP2-33870] - Canine optic nerve. Immunofluorescent signal was detected using Alexa Fluor 488 conjugated secondary antibody (green). IHC-Fr image submitted by a verified customer review.
P2Y12/P2RY12 Antibody

Immunohistochemistry: P2Y12/P2RY12 Antibody [NBP2-33870] -

Immunohistochemistry: P2Y12/P2RY12 Antibody [NBP2-33870] - Images demonstrating colocalization of CD105/MAB1097 with microglial markers (a) panels A, B Low magnification images of high-plaque (HP) case (panel A) & AD case (panel B) showing staining with CD105/MAB1097 (purple arrows) & IBA-1 (brown arrows) in MTG sections. Both images at same magnification: scale bars represent 100 μm. (b) (panel A) CD105 microglia (purple arrows) with ramified morphology stained with antibody to P2RY12 (brown arrow) in low-plaque (LP) case. (panel B) CD105 microglia (purple arrows) & HLA-DR (brown arrow) in AD case. (panel C) CD105 microglia (purple arrow) & CD45 (brown arrow) in AD case. All sections were from MTG. Images at same magnification: scale bars represent 50 μm. (c) (panel A–E). Patterns of staining of CD105 (purple) & IBA-1 (brown) in MTG sections of cases with progressively increasing pathology from LP to AD. (panel F). CD105-positive microglia in hippocampus (HPC) of AD case. Images at same magnification: scale bars represent 50 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31340569), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for P2Y12/P2RY12 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

validated from a verified customer review

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Frozen

Validated from a verified customer review

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Multiplex Immunofluorescence

1:100

Simple Western

1:250

Western Blot

reported in scientific literature (PMID:31968618).
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 3 reviews rated 3.3 using NBP2-33870 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: P2Y12/P2RY12

P2Y12 is a Purinergic Receptor essential for the aggregation of blood platelets. There is evidence that mutations in P2Y12 cause a bleeding disorder, suggesting that knowledge of the P2Y12 receptor could advance the development of antiplatelet agents to treat cardiovascular diseases. Expression of P2Y12 has been reported in platelets, spinal cord, and many brain regions. ESTs for P2Y12 have been isolated from B-cell/lung/testis, brain, embryo, prostate, eye, kidney carcinoma, and colon carcinoma libraries. Cognate

Long Name

P2Y Purinergic Receptor 12

Alternate Names

ADPG-R, HORK3, P2RY12, SP1999

Gene Symbol

P2RY12

Additional P2Y12/P2RY12 Products

Product Documents for P2Y12/P2RY12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for P2Y12/P2RY12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for P2Y12/P2RY12 Antibody - BSA Free

Customer Reviews for P2Y12/P2RY12 Antibody - BSA Free (3)

3.3 out of 5
3 Customer Ratings
5 Stars
33%
4 Stars
33%
3 Stars
0%
2 Stars
0%
1 Stars
33%

Have you used P2Y12/P2RY12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 3 of 3 reviews Showing All
Filter By:
Clear Filters X
  • P2Y12/P2RY12 Antibody
    Name: Helena Morrison
    Application: Immunohistochemistry-Fixed; cryoprotected
    Sample Tested: Mouse brain
    Species: Mouse
    Verified Customer | Posted 02/07/2020
    Mouse cortex 40X Leica DM6000
    Free floating coronal sections 50um. 72 hr primary @ RT with 4hr secondary @ RT.
    P2Y12/P2RY12 Antibody - BSA Free NBP2-33870
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
  • P2Y12/P2RY12 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Frozen
    Sample Tested: Optic nerve
    Species: Canine
    Verified Customer | Posted 08/07/2018
    NBP2-33870 immunofluorescent signal was detected using Alexa Fluor 488 conjugated secondary antibody (green).
    P2Y12/P2RY12 Antibody - BSA Free NBP2-33870
  • P2Y12/P2RY12 Antibody
    Name: Anonymous
    Application: Immunocytochemistry
    Sample Tested: optic nerve
    Species: Feline
    Verified Customer | Posted 05/11/2017
    Green-P2Y12/P2RY12, Blue-DAPI
    1:200 dilution for fixed tissue sections.
    P2Y12/P2RY12 Antibody - BSA Free NBP2-33870

There are no reviews that match your criteria.

Showing  1 - 3 of 3 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies