P2Y14/GPR105 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86743

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all P2Y14/GPR105 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of P2Y14/GPR105. Peptide sequence: LKSSRNSTSVKKKSSRNIFSIVFVFFVCFVPYHIARIPYTKSQTEAHYSC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for P2Y14/GPR105 Antibody - BSA Free

Western Blot: P2Y14/GPR105 Antibody [NBP2-86743]

Western Blot: P2Y14/GPR105 Antibody [NBP2-86743]

Western Blot: P2Y14/GPR105 Antibody [NBP2-86743] - WB Suggested Anti-P2RY14 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Heart

Applications for P2Y14/GPR105 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: P2Y14/GPR105

GPR105 is a Sugar-Sensing Receptor. GPR105 is a G-protein-coupled receptor identifying a quiescent, primitive population of hematopoietic cells restricted to bone marrow. GPC105 has been suggested to mediates primitive cell responses to specific hematopoietic microenvironments and extends the known immune system functions of P2Y receptors to the stem cell level. GPR105 has also been suggested to play an important role in peripheral and neuroimmune function in response to extracellular UDP-sugars. GPR105 has been reported to be expressed in brain. ESTs have been isolated from kidney, placenta, uterus, and heart/melanocyte/uterus libraries.

Long Name

P2Y Purinergic Receptor 14

Alternate Names

GPR105, P2RY14

Gene Symbol

P2RY14

Additional P2Y14/GPR105 Products

Product Documents for P2Y14/GPR105 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for P2Y14/GPR105 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for P2Y14/GPR105 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review P2Y14/GPR105 Antibody - BSA Free and earn rewards!

Have you used P2Y14/GPR105 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies