P4HA3 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94641

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all P4HA3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human P4HA3 (NP_878907.1). DPERAAARGDTFSALTSVARALAPERRLLGLLRRYLRGEEARLRDLTRFYDKVLSLHEDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEAS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for P4HA3 Antibody - Azide and BSA Free

Western Blot: P4HA3 AntibodyAzide and BSA Free [NBP2-94641]

Western Blot: P4HA3 AntibodyAzide and BSA Free [NBP2-94641]

Western Blot: P4HA3 Antibody [NBP2-94641] - Western blot analysis of extracts of various cell lines, using P4HA3 antibody (NBP2-94641) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.
Western Blot: P4HA3 AntibodyAzide and BSA Free [NBP2-94641]

Western Blot: P4HA3 AntibodyAzide and BSA Free [NBP2-94641]

Western Blot: P4HA3 Antibody [NBP2-94641] - Analysis of extracts of 293T cells, using P4HA3 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time:
P4HA3 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: P4HA3 Antibody - Azide and BSA Free [P4HA3] -

Immunocytochemistry/ Immunofluorescence: P4HA3 Antibody - Azide and BSA Free [P4HA3] - Immunofluorescence analysis of NIH/3T3 cells using P4HA3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for P4HA3 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: P4HA3

The P4HA3 gene encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part o

Alternate Names

2-oxoglutarate-4-dioxygenase subunit alpha-3, 4-PH alpha-3, alpha polypeptide III, collagen prolyl 4-hydroxylase alpha(III), C-P4H alpha III, C-P4Halpha(III), EC 1.14.11.2, Procollagen-proline, procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), prolyl 4-hydroxylase subunit alpha-3, prolyl 4-hydroxylase, alpha polypeptide III

Gene Symbol

P4HA3

Additional P4HA3 Products

Product Documents for P4HA3 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for P4HA3 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for P4HA3 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review P4HA3 Antibody - Azide and BSA Free and earn rewards!

Have you used P4HA3 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies