p66 alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88000

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all p66 alpha Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human p66 alpha. Peptide sequence: RMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQKPTGSVGSTVTTPPP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for p66 alpha Antibody - BSA Free

Western Blot: p66 alpha Antibody [NBP2-88000]

Western Blot: p66 alpha Antibody [NBP2-88000]

Western Blot: p66 alpha Antibody [NBP2-88000] - WB Suggested Anti-GATAD2A Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: THP-1 cell lysate

Applications for p66 alpha Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: p66 alpha

Methylation of cytosine at CpG dinucleotides is a common feature of many higher eukaryotic genomes (1-3). Increasing evidence indicates that recruitement of histone deacetylase complexes by methyl-CpG-binding proteins (MeCP) is a major mechanism of methylated DNA silencing. P66, a zinc finger-containing protein is one of the components of the MeCP1 complex (4). P66 and p68, the two components of MeCP1 are different forms of the same zinc finger-containing protein and are conserved from C.elegans to humans. Homologs of p66 from different organisms revealed two highly conserved regions, CR1 and CR2. While CR1 is involved in the association of p66 with other MeCP1 components, CR2 plays an important role in targeting p66 and MBD3 to specific loci (4).

Alternate Names

FLJ20085, FLJ21017, GATA zinc finger domain containing 2A, GATA zinc finger domain-containing protein 2A, Hp66alpha, p66 alpha, p66alpha, transcriptional repressor p66-alpha

Gene Symbol

GATAD2A

Additional p66 alpha Products

Product Documents for p66 alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for p66 alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for p66 alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review p66 alpha Antibody - BSA Free and earn rewards!

Have you used p66 alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies