PAC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88003

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PAC2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAC2. Peptide sequence: PSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDES The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit PAC2 Antibody - BSA Free (NBP2-88003) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PAC2 Antibody - BSA Free

Western Blot: PAC2 Antibody [NBP2-88003]

Western Blot: PAC2 Antibody [NBP2-88003]

Western Blot: PAC2 Antibody [NBP2-88003] - Host: Rabbit. Target Name: PSMG2. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for PAC2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAC2

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization

Alternate Names

CLAST3HSPC260, HCCA3PAC-2, hepatocellular carcinoma susceptibility protein, Hepatocellular carcinoma-susceptibility protein 3, HsT1707, likely ortholog of mouse CD40 ligand-activated specific transcript 3 (Clast3), MDS003, MGC15092, PAC2HDCMC29P, proteasome (prosome, macropain) assembly chaperone 2, proteasome assembling chaperone 2, proteasome assembly chaperone 2, TNFSF5IP1CD40 ligand-activated specific transcript 3, Tumor necrosis factor superfamily member 5-induced protein 1, tumor necrosis factor superfamily, member 5-induced protein 1, x 003 protein

Gene Symbol

PSMG2

Additional PAC2 Products

Product Documents for PAC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PAC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAC2 Antibody - BSA Free and earn rewards!

Have you used PAC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies