PAIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57494

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PAIP1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PAIP1(poly(A) binding protein interacting protein 1) The peptide sequence was selected from the N terminal of PAIP1. Peptide sequence MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PAIP1 Antibody - BSA Free

Western Blot: PAIP1 Antibody [NBP1-57494]

Western Blot: PAIP1 Antibody [NBP1-57494]

Western Blot: PAIP1 Antibody [NBP1-57494] - Human Heart lysate, concentration 0.2-1 ug/ml.

Applications for PAIP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAIP1

PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.The protein encoded by this gene interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.The protein encoded by this gene interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.

Alternate Names

MGC12360, PABC1-interacting protein 1, PABP-interacting protein 1, PAIP-1, poly(A) binding protein interacting protein 1, Poly(A)-binding protein-interacting protein 1, polyadenylate binding protein-interacting protein 1, polyadenylate-binding protein-interacting protein 1

Gene Symbol

PAIP1

UniProt

Q9H074-2 (Human)

Additional PAIP1 Products

Product Documents for PAIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PAIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAIP1 Antibody - BSA Free and earn rewards!

Have you used PAIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies