Pallidin Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37913

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Pallidin Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human Pallidin (NP_036520.1).

Sequence:
MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Pallidin Antibody - BSA Free

Pallidin Antibody

Western Blot: Pallidin Antibody [NBP3-37913] -

Western Blot: Pallidin Antibody [NBP3-37913] - Western blot analysis of various lysates using Pallidin Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for Pallidin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:200 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Pallidin

Pallidin, encoded by gene HGNC, may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Alternate Names

PALLID, pallid (mouse) homolog, pallidin, Pallid protein homolog, pallidin, pallidin homolog (mouse), PAsyntaxin 13 binding protein 1, Syntaxin 13-interacting protein, syntaxin 13-interacting protein pallid

Gene Symbol

BLOC1S6

Additional Pallidin Products

Product Documents for Pallidin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Pallidin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Pallidin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Pallidin Antibody - BSA Free and earn rewards!

Have you used Pallidin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies