PALS1/MPP5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54724

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to MPP5(membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5)) The peptide sequence was selected from the N terminal of MPP5 (NP_071919.2). AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PALS1/MPP5 Antibody - BSA Free

Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for PALS1/MPP5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PALS1/MPP5

Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like, ZO1-like, p55-like, and LIN2-like, based on their size and the presence of additional domains. MPP5 is a member of the p55-like MAGUK subfamily.Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like (see DLG1; MIM 601014), ZO1-like (see TJP1; MIM 601009), p55-like (see MPP1; MIM 305360), and LIN2-like (see CASK; MIM 300172), based on their size and the presence of additional domains (Tseng et al., 2001 [PubMed 11311936]). MPP5 is a member of the p55-like MAGUK subfamily.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Protein Associated with Lin Seven 1

Alternate Names

MPP5, Stardust

Entrez Gene IDs

64398 (Human)

Gene Symbol

MPP5

UniProt

Additional PALS1/MPP5 Products

Product Documents for PALS1/MPP5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PALS1/MPP5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for PALS1/MPP5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PALS1/MPP5 Antibody - BSA Free and earn rewards!

Have you used PALS1/MPP5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...