PAPD5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88011

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAPD5. Peptide sequence: SSSKGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRKHKRDAPLSDLCR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PAPD5 Antibody - BSA Free

Western Blot: PAPD5 Antibody [NBP2-88011]

Western Blot: PAPD5 Antibody [NBP2-88011]

Western Blot: PAPD5 Antibody [NBP2-88011] - Host: Rabbit. Target Name: PAPD5. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1ug/ml
Immunohistochemistry-Paraffin: PAPD5 Antibody [NBP2-88011]

Immunohistochemistry-Paraffin: PAPD5 Antibody [NBP2-88011]

Immunohistochemistry-Paraffin: PAPD5 Antibody [NBP2-88011] - Rabbit Anti-TENT4B antibody. Formalin Fixed Paraffin Embedded Tissue: Human Liver. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec
Western Blot: PAPD5 Antibody [NBP2-88011]

Western Blot: PAPD5 Antibody [NBP2-88011]

Western Blot: PAPD5 Antibody [NBP2-88011] - Host: Rabbit. Target Name: TENT4B. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

Applications for PAPD5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAPD5

PAPD5 plays a role in replication-dependent histone mRNA degradation. May be involved in the terminal uridylationof mature histone mRNAs before their degradation is initiated. DNA polymerase, probably involved in DNA repair. Mayplay a role in sister chromatid c

Alternate Names

EC 2.7.7, EC 2.7.7.-, FLJ40270, PAP associated domain containing 5, Terminal uridylyltransferase 3, Topoisomerase-related function protein 4-2, TRF4-2PAP-associated domain-containing protein 5, TUTase 3

Gene Symbol

TENT4B

Additional PAPD5 Products

Product Documents for PAPD5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PAPD5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAPD5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAPD5 Antibody - BSA Free and earn rewards!

Have you used PAPD5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...