PAPSS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56643

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PAPSS2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VVELLQEQNIVPYTIIKDIHELFVPENKLDHVRAEAETLPSLSITKLDLQWVQV

Reactivity Notes

Mouse 85%, Rat 81%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PAPSS2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PAPSS2 Antibody [NBP2-56643]

Immunocytochemistry/ Immunofluorescence: PAPSS2 Antibody [NBP2-56643]

Immunocytochemistry/Immunofluorescence: PAPSS2 Antibody [NBP2-56643] - Staining of human cell line U-2 OS shows localization to mitochondria.

Applications for PAPSS2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAPSS2

Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.

Alternate Names

3'-phosphoadenosine 5'-phosphosulfate synthase 2, ATP sulfurylase/adenosine 5'-phosphosulfate kinase, ATPSK2ATP sulfurylase/APS kinase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2, EC 2.7.1.25, PAPS synthase 2, PAPS synthetase 2, PAPSS 2, SK 2, SK2, Sulfurylase kinase 2,3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2

Gene Symbol

PAPSS2

Additional PAPSS2 Products

Product Documents for PAPSS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PAPSS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAPSS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAPSS2 Antibody - BSA Free and earn rewards!

Have you used PAPSS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies