PAQR8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83357

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PAQR8 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAQR8. Peptide sequence: QGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PAQR8 Antibody - BSA Free

Western Blot: PAQR8 Antibody [NBP2-83357]

Western Blot: PAQR8 Antibody [NBP2-83357]

Western Blot: PAQR8 Antibody [NBP2-83357] - WB Suggested Anti-PAQR8 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Lung

Applications for PAQR8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAQR8

Progestin Receptor Beta-extra recognizes the extracellular epitope of the membrane progestin receptor. Progestin receptors with are found in pituitary, reproductive tract and most estrogen receptor-containing brain regions; these receptors are inducible by estrogen treatment. There are also progestin receptor sites in brain areas lacking estrogen receptors, such as the cerebral cortex of the rat; these receptors are not induced by estradiol treatment. Nevertheless, such receptors resemble those induced by estradiol. Another inducer of progestin receptors in brain is testosterone, which works through its conversion to estradiol via aromatization.

Alternate Names

C6orf33Lysosomal membrane protein in brain 1, LMPB1FLJ32521, lysosomal membrane protein in brain-1, membrane progestin receptor beta, mPR beta, MPRBFLJ46206, Progestin and adipoQ receptor family member 8, progestin and adipoQ receptor family member VIIIchromosome 6 open reading frame 33

Gene Symbol

PAQR8

Additional PAQR8 Products

Product Documents for PAQR8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PAQR8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAQR8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAQR8 Antibody - BSA Free and earn rewards!

Have you used PAQR8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies