Parathyroid hormone 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69679

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Parathyroid hormone 2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PTH2(parathyroid hormone 2) The peptide sequence was selected from the middle region of PTH2. Peptide sequence WADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Parathyroid hormone 2 Antibody - BSA Free

Western Blot: Parathyroid hormone 2 Antibody [NBP1-69679]

Western Blot: Parathyroid hormone 2 Antibody [NBP1-69679]

Western Blot: parathyroid hormone 2 Antibody [NBP1-69679] - This Anti-PTH2 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Applications for Parathyroid hormone 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Parathyroid hormone 2

TIP39 is related to parathyroid hormone (PTH) and PTH-related protein (PTHRP) and is a ligand for PTH receptor-2.TIP39 is related to parathyroid hormone (PTH; MIM 168450) and PTH-related protein (PTHRP; MIM 168470) and is a ligand for PTH receptor-2 (PTHR2; MIM 601469) (John et al., 2002 [PubMed 11861531]).[supplied by OMIM].

Alternate Names

parathyroid hormone 2TIP39tuberoinfundibular 39 residue protein, TIPF39, tuberoinfundibular 39 residues, tuberoinfundibular peptide of 39 residues

Gene Symbol

PTH2

UniProt

Q96A98 (Human)

Additional Parathyroid hormone 2 Products

Product Documents for Parathyroid hormone 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Parathyroid hormone 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Parathyroid hormone 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Parathyroid hormone 2 Antibody - BSA Free and earn rewards!

Have you used Parathyroid hormone 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies