PARP Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-36747PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Applications

Antibody Competition
View all PARP Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PARP1.

Source: E. coli

Amino Acid Sequence: KGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-36747.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-36747PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PARP

Poly (ADP-ribose) polymerase (PARP) is protein family primarily invloved in DNA repair and programmed cell death. PARP proteins are activated in response to DNA single strand breaks (SSBs). Upon SSB detection, PARP binds the DNA and synthesizes a PAR chain at the damaged site, which then signals the initiation of DNA repair by other enzymes such as XRCC1, DNA ligase III and DNA polymerase beta. After repair, the PAR chains are degraded via PAR glycohydrolase.

PARP is inactivated by caspase cleavage, leading to a programmed cell death pathway.

Long Name

Poly [ADP-ribose] Polymerase

Alternate Names

ADPRT, PARP1, PPOL

Gene Symbol

PARP1

Additional PARP Products

Product Documents for PARP Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PARP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for PARP Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review PARP Recombinant Protein Antigen and earn rewards!

Have you used PARP Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for PARP Recombinant Protein Antigen

Showing  1 - 2 of 2 FAQs Showing All

  • Q: Do you have any 100 coda or bigger controls?

    A:

    I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.

  • Q: I was wondering if you would mind letting me know which product would you recommend for immunochemistry of the retina of the rat and mouse by poly (ADP-ribose) polymerase (PARP) and calpain. There are many different calpain antibodies in your website. The samples are 12-um vertical cryostst sections (fixed by PFA).

    A: For PARP, I would recommend either NB120-2168 or NB100-64828. Bear in mind that they are both mouse monoclonals, and you may have to take extra steps to reduce mouse-on-mouse background.

  • Q: Do you have any 100 coda or bigger controls?

    A:

    I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.

  • Q: I was wondering if you would mind letting me know which product would you recommend for immunochemistry of the retina of the rat and mouse by poly (ADP-ribose) polymerase (PARP) and calpain. There are many different calpain antibodies in your website. The samples are 12-um vertical cryostst sections (fixed by PFA).

    A: For PARP, I would recommend either NB120-2168 or NB100-64828. Bear in mind that they are both mouse monoclonals, and you may have to take extra steps to reduce mouse-on-mouse background.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Proteins and Enzymes