PCGF6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55372

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PCGF6 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to the middle region of human PCGF6 (polycomb group ring finger 6)(NP_115530). Peptide sequence: TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PCGF6 Antibody - BSA Free

Western Blot: PCGF6 Antibody [NBP1-55372]

Western Blot: PCGF6 Antibody [NBP1-55372]

Western Blot: PCGF6 Antibody [NBP1-55372] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Applications for PCGF6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PCGF6

The protein encoded by this gene contains a RING finger motif, which is most closely related to those of polycomb group (PcG) proteins RNF110/MEL-18 and BMI1. PcG proteins are known to form protein complexes and function as transcription repressors. This protein has been shown to interact with some PcG proteins and act as a transcription repressor. The activity of this protein is found to be regulated by cell cycle dependent phosphorylation. Alternatively spliced transcript variants encoding different isoforms have been identified.

Alternate Names

MBLRMel18 and Bmi1-like RING finger protein, MGC15678, MGC17541, polycomb group ring finger 6, RING finger protein 134polycomb group RING finger protein 6, RNF134Mel18 and Bmi1-like RING finger

Entrez Gene IDs

84108 (Human)

Gene Symbol

PCGF6

UniProt

Q9BYE7 (Human)

Additional PCGF6 Products

Product Documents for PCGF6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PCGF6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PCGF6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PCGF6 Antibody - BSA Free and earn rewards!

Have you used PCGF6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies