PDCD7 Antibody (8A1Q3)

Novus Biologicals | Catalog # NBP3-15482

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8A1Q3 expressed in HEK293
View all PDCD7 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PDCD7 (Q8N8D1). MALPPFFGQGRPGPPPPQPPPPAPFGCPPPPLPSPAFPPPLPQRPGPFPGASAPFLQPPLALQPRASAEASRGGGGAGAFYPVPPPPLPPPPPQCRPFPG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PDCD7 Antibody (8A1Q3)

Western Blot: PDCD7 Antibody (8A1Q3) [NBP3-15482]

Western Blot: PDCD7 Antibody (8A1Q3) [NBP3-15482]

Western Blot: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Western blot analysis of extracts of various cell lines, using PDCD7 antibody (NBP3-15482) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: PDCD7 Antibody (8A1Q3) [NBP3-15482]

Western Blot: PDCD7 Antibody (8A1Q3) [NBP3-15482]

Western Blot: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Western blot analysis of extracts of Rat brain, using PDCD7 antibody (NBP3-15482) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
PDCD7 Antibody (8A1Q3)

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] -

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Immunohistochemistry analysis of PDCD7 in paraffin-embedded human breast tissue using PDCD7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PDCD7 Antibody (8A1Q3)

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] -

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Immunohistochemistry analysis of PDCD7 in paraffin-embedded human small intestine tissue using PDCD7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PDCD7 Antibody (8A1Q3)

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] -

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Immunohistochemistry analysis of PDCD7 in paraffin-embedded human esophagus tissue using PDCD7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PDCD7 Antibody (8A1Q3)

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] -

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Immunohistochemistry analysis of PDCD7 in paraffin-embedded mouse intestin tissue using PDCD7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PDCD7 Antibody (8A1Q3)

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] -

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Immunohistochemistry analysis of PDCD7 in paraffin-embedded human breast cancer tissue using PDCD7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PDCD7 Antibody (8A1Q3)

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] -

Immunohistochemistry: PDCD7 Antibody (8A1Q3) [NBP3-15482] - Immunohistochemistry analysis of PDCD7 in paraffin-embedded rat liver tissue using PDCD7 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for PDCD7 Antibody (8A1Q3)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PDCD7

PDCD7 encodes a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramide-mediated signalling. These observations suggest that this gene product is involved in specific apoptotic processes in T-cells.

Alternate Names

apoptosis-related protein ES18, ES18programmed cell death protein 7, FLJ54213, HES18, MGC22015, programmed cell death 7, U11/U12 snRNP 59K

Gene Symbol

PDCD7

Additional PDCD7 Products

Product Documents for PDCD7 Antibody (8A1Q3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PDCD7 Antibody (8A1Q3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PDCD7 Antibody (8A1Q3)

There are currently no reviews for this product. Be the first to review PDCD7 Antibody (8A1Q3) and earn rewards!

Have you used PDCD7 Antibody (8A1Q3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies