PDE12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-70672

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PDE12 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to 2'-PDE The peptide sequence was selected from the middle region of 2'-PDE. Peptide sequence CLDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKW. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PDE12 Antibody - BSA Free

Western Blot: PDE12 Antibody [NBP1-70672]

Western Blot: PDE12 Antibody [NBP1-70672]

Western Blot: PDE12 Antibody [NBP1-70672] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: PDE12 Antibody [NBP1-70672]

Western Blot: PDE12 Antibody [NBP1-70672]

Western Blot: PDE12 Antibody [NBP1-70672] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Applications for PDE12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PDE12

2'-PDE is an enzyme that cleaves 2',5'-phosphodiester bond linking adenosines of the 5'-triphosphorylated oligoadenylates, triphosphorylated oligoadenylates referred as 2-5A modulates the 2-5A system. This enzyme degraded triphosphorylated 2-5A to produce AMP and ATP. 2'-PDE also cleaves 3',5'-phosphodiester bond of oligoadenylates. 2'-PDE play a role as a negative regulator of the 2-5A system that is one of the major pathways for antiviral and antitumor functions induced by interferons (IFNs). Suppression of this enzyme induces reduction of viral replication in Hela cells, thus counteracting the antiviral pathway probably by inhibiting the 2-5A system.

Alternate Names

2'-PDE, phosphodiesterase 12

Gene Symbol

PDE12

Additional PDE12 Products

Product Documents for PDE12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PDE12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PDE12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PDE12 Antibody - BSA Free and earn rewards!

Have you used PDE12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies