PDGF-D/SCDGFB Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55053

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PDGF-D Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASETNWESVTSSISGV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit PDGF-D/SCDGFB Antibody - BSA Free (NBP2-55053) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PDGF-D/SCDGFB Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PDGF-D/SCDGFB Antibody [NBP2-55053]

Immunocytochemistry/ Immunofluorescence: PDGF-D/SCDGFB Antibody [NBP2-55053]

Immunocytochemistry/Immunofluorescence: PDGF-D/SCDGFB Antibody [NBP2-55053] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.

Applications for PDGF-D/SCDGFB Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PDGF-D

SCDGFB is encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines, seven of which are found in this factor. This gene product only forms homodimers and, therefore, does not dimerize with the other three family members. It differs from alpha and beta members of this family in having an unusual N-terminal domain, the CUB domain. Two splice variants have been identified for this gene. [provided by RefSeq]

Long Name

Platelet-derived Growth Factor D

Alternate Names

PDGFD

Gene Symbol

PDGFD

Additional PDGF-D Products

Product Documents for PDGF-D/SCDGFB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PDGF-D/SCDGFB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

PDGF Family

Customer Reviews for PDGF-D/SCDGFB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PDGF-D/SCDGFB Antibody - BSA Free and earn rewards!

Have you used PDGF-D/SCDGFB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies