PEO1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57356

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PEO1 The peptide sequence was selected from the middle region of PEO1. Peptide sequence GVFRKFATDNNCHVTLVIHPRKEDDDKELQTASIFGSAKASQEADNVLIL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PEO1 Antibody - BSA Free

Western Blot: PEO1 Antibody [NBP1-57356]

Western Blot: PEO1 Antibody [NBP1-57356]

Western Blot: PEO1 Antibody [NBP1-57356] - Sample Tissue: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 12%
Western Blot: PEO1 Antibody [NBP1-57356]

Western Blot: PEO1 Antibody [NBP1-57356]

Western Blot: PEO1 Antibody [NBP1-57356] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for PEO1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PEO1

Twinkle is a mitochondrial protein with structural similarity to the phage T7 primase/helicase (GP4) and other hexameric ring helicases. The twinkle protein colocalizes with mtDNA in mitochondrial nucleoids, and its name derives from the unusual localization pattern reminiscent of twinkling stars.Twinkle is a mitochondrial protein with structural similarity to the phage T7 primase/helicase (GP4) and other hexameric ring helicases. The twinkle protein colocalizes with mtDNA in mitochondrial nucleoids, and its name derives from the unusual localization pattern reminiscent of twinkling stars (Spelbrink et al., 2001 [PubMed 11431692]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-213 BG473173.1 6-218 214-1706 BX640829.1 215-1707 1707-3630 BC033762.1 719-2642

Alternate Names

ATXN8, chromosome 10 open reading frame 2, EC 3.6.4.12, FLJ21832, infantile onset spinocerebellar ataxia (autosomal recessive), IOSCA, mitochondrial, MTDPS7, PEO1PEOA3, TWINKLE

Gene Symbol

TWNK

UniProt

Additional PEO1 Products

Product Documents for PEO1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PEO1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PEO1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PEO1 Antibody - BSA Free and earn rewards!

Have you used PEO1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...