PEPP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10549

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PEPP3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat PEPP3 (XP_001060716). Peptide sequence SATYSSNSPASPLSSASLTSPLSPFSMVSGSQGSPTKPGSSEPKTDYEPS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

120 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PEPP3 Antibody - BSA Free

Western Blot: PEPP3 Antibody [NBP3-10549]

Western Blot: PEPP3 Antibody [NBP3-10549]

Western Blot: PEPP3 Antibody [NBP3-10549] - Western blot analysis of PEPP3 in Rat Testis lysates. Antibody dilution at 1.0ug/ml

Applications for PEPP3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PEPP3

GenBank Accession Number - NP_055750. PEPP3 contains an N-terminal pleckstrin homology (PH) domain. It shares significant homology with PEPP1 and PEPP2 only in the PH domain.

Alternate Names

KIAA0969MGC176733, PEPP-3, PEPP3Phosphoinositol 3-phosphate-binding protein 3, PH domain-containing family A member 6, phosphoinositol 3-phosphate-binding protein-3, pleckstrin homology domain containing, family A member 6, pleckstrin homology domain-containing family A member 6

Gene Symbol

PLEKHA6

Additional PEPP3 Products

Product Documents for PEPP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PEPP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PEPP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PEPP3 Antibody - BSA Free and earn rewards!

Have you used PEPP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies