Peptide YY (3-36) human

   
Product Datasheet
Catalog Number:6288
Chemical Name:
Product Details
Supplemental Products
Reviews
Biological Activity
NPY Y2 receptor agonist. Peripheral administration inhibits food intake in mice. This effect is greater when Peptide YY (3-36) is administered in combination with GLP-1 (7-36) (Cat.No. 2082).
Technical Data
  • M.Wt:
    4049.51
  • Formula:
    C180H279N53O54
  • Sequence:
    IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY

    (Modifications: Tyr-34 = C-terminal amide)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Store at -20°C
  • CAS No:
    123583-37-9
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Product Datasheets

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs
VersaClone cDNA Plasmids
Description Application Cat# Citations Images  

Human NPY2R (NP_000901) VersaClone cDNA

RDC0157
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Have you used Peptide YY (3-36) human?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee