Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69318

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PAM(peptidylglycine alpha-amidating monooxygenase) The peptide sequence was selected from the N terminal of PAM. Peptide sequence PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

108 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free

Western Blot: Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody [NBP1-69318]

Western Blot: Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody [NBP1-69318]

Western Blot: PAM Antibody [NBP1-69318] - This Anti-PAM antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.

Applications for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAM

PAM is a multifunctional protein. It has two enzymatically active domains with catalytic activities-peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products.This gene encodes a multifunctional protein. It has two enzymatically active domains with catalytic activities - peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene but some of their full length sequences are not yet known.

Long Name

Peptidylglycine Alpha-Amidating Monooxygenase

Alternate Names

PAL, PHM

Gene Symbol

PAM

UniProt

Additional PAM Products

Product Documents for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free and earn rewards!

Have you used Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free

Showing  1 - 2 of 2 FAQs Showing All
  • Q: Do you provide samples for testing these in new applications? Many companies, recognizing the benefit to their business of extending applications to new species (as well as the risk taken by research teams to test expensive antibodies in new applications), will provide a small, free sample for this purpose. Please let me know.

    A:

    We unfortunately do not provide free samples, but we do offer our Innovator's Reward Program for untested applications or species. Our Innovator’s Reward™ program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. Submit an online review detailing your results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product to use in a future purchase of your choice.

  • Q: I'm looking for a polyclonal antibody for Peptidyl-glycine alpha-amidating monooxygenase (PAM) that works in mouse and for immune-fluorescence experiments. I found the following product on your website: NBP1-62288 but the specificity is towards human and has only been tested for western blot. Could I use this antibody for my studies? If not, would you know/have an other antibody that would suit my needs?

    A: NBP1-62288 is now sold as catalogue number NBP1-69318. Please accept my apologies for any confusion which may have been caused by this change. As you rightly point out, this rabbit polyclonal antibody has been validated for Western blotting with samples from mouse, but has not yet been tested in immunofluorescence. Should you wish to try this antibody for immunofluorescence I can highly recommend our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply need to go to the antibody’s webpage and complete an online review with an image, detailing the positive or negative results of your study. In return you will receive a discount voucher for 100% of the purchase price of the reviewed product.

  • Q: Do you provide samples for testing these in new applications? Many companies, recognizing the benefit to their business of extending applications to new species (as well as the risk taken by research teams to test expensive antibodies in new applications), will provide a small, free sample for this purpose. Please let me know.

    A:

    We unfortunately do not provide free samples, but we do offer our Innovator's Reward Program for untested applications or species. Our Innovator’s Reward™ program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. Submit an online review detailing your results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product to use in a future purchase of your choice.

  • Q: I'm looking for a polyclonal antibody for Peptidyl-glycine alpha-amidating monooxygenase (PAM) that works in mouse and for immune-fluorescence experiments. I found the following product on your website: NBP1-62288 but the specificity is towards human and has only been tested for western blot. Could I use this antibody for my studies? If not, would you know/have an other antibody that would suit my needs?

    A: NBP1-62288 is now sold as catalogue number NBP1-69318. Please accept my apologies for any confusion which may have been caused by this change. As you rightly point out, this rabbit polyclonal antibody has been validated for Western blotting with samples from mouse, but has not yet been tested in immunofluorescence. Should you wish to try this antibody for immunofluorescence I can highly recommend our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply need to go to the antibody’s webpage and complete an online review with an image, detailing the positive or negative results of your study. In return you will receive a discount voucher for 100% of the purchase price of the reviewed product.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies
Loading...