PET112L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85460

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PET112L Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PET112L. Peptide sequence: GSTSNQIRGESSVAQQPLHTAQKTRKGEHKWAAVVGLEIHAQISSNSKLF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PET112L Antibody - BSA Free

Western Blot: PET112L Antibody [NBP2-85460]

Western Blot: PET112L Antibody [NBP2-85460]

Western Blot: PET112L Antibody [NBP2-85460] - Host: Rabbit. Target Name: PET112. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/mlPET112 is supported by BioGPS gene expression data to be expressed in 721_B

Applications for PET112L Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PET112L

Furnishes a means for formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln) (Potential)

Alternate Names

Cytochrome oxidase assembly factor PET112 homolog, EC 6.3.5, EC 6.3.5.-, Glu-ADT subunit B, mitochondrial, PET112 (yeast homolog)-like, PET112-like (yeast)

Gene Symbol

PET112

Additional PET112L Products

Product Documents for PET112L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PET112L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PET112L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PET112L Antibody - BSA Free and earn rewards!

Have you used PET112L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies