PEX10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60050

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PEX10 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PEX10(peroxisome biogenesis factor 10) The peptide sequence was selected from the C terminal of PEX10. Peptide sequence ERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PEX10 Antibody - BSA Free

Western Blot: PEX10 Antibody [NBP1-60050]

Western Blot: PEX10 Antibody [NBP1-60050]

Western Blot: PEX10 Antibody [NBP1-60050] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Applications for PEX10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PEX10

PEX10 is a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in PEX10 gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome.This gene encodes a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in this gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome. Alternative splicing results in two transcript variants encoding different isoforms.

Alternate Names

NALD, peroxin 10, peroxin-10, peroxisomal biogenesis factor 10MGC1998, Peroxisome assembly protein 10, RING finger protein 69, RNF69peroxisome biogenesis factor 10

Gene Symbol

PEX10

UniProt

O60683 (Human)

Additional PEX10 Products

Product Documents for PEX10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PEX10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PEX10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PEX10 Antibody - BSA Free and earn rewards!

Have you used PEX10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies