PEX11A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59705

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PEX11A Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PEX11A(peroxisomal biogenesis factor 11A) The peptide sequence was selected from the middle region of PEX11A (NP_003838). Peptide sequence MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PEX11A Antibody - BSA Free

Western Blot: PEX11A Antibody [NBP1-59705]

Western Blot: PEX11A Antibody [NBP1-59705]

Western Blot: PEX11A Antibody [NBP1-59705] - Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.

Applications for PEX11A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PEX11A

PEX11A belongs to the peroxin-11 family. It may be involved in peroxisomal proliferation and may regulate peroxisomes division. PEX11A may mediate binding of coatomer proteins to the peroxisomal membrane.

Alternate Names

28 kDa peroxisomal integral membrane protein, HsPEX11p, MGC119947, MGC138534, Peroxin-11A, peroxisomal biogenesis factor 11 alpha, Peroxisomal biogenesis factor 11Aperoxin-11A, peroxisomal membrane protein 11A, PEX11, PEX11-ALPHA, PMP28, Protein PEX11 homolog alpha

Entrez Gene IDs

8800 (Human)

Gene Symbol

PEX11A

UniProt

O75192 (Human)

Additional PEX11A Products

Product Documents for PEX11A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PEX11A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PEX11A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PEX11A Antibody - BSA Free and earn rewards!

Have you used PEX11A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies