PF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09274

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PF1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PF1 (NP_001028733). Peptide sequence NVLYSCDFSEKTPPTPPSSIVAKVQSVIRRRRHQKQDEEPSEEAAMMSSQ

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

110 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PF1 Antibody - BSA Free

Western Blot: PF1 Antibody [NBP3-09274]

Western Blot: PF1 Antibody [NBP3-09274]

Western Blot: PF1 Antibody [NBP3-09274] - Western blot analysis using NBP3-09274 on Human Brain as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for PF1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PF1

PHD factor 1 (PF1) was identified as a protein that interacts with mSin3A-histone deacetylase corepressor, a multiprotein complex that mediates transcriptional repression. PF1 is a plant homeodomain zinc finger protein that also bears a forkhead-associated (FHA) domain. PF1 appears to facilitate the recruitment of the mSin3A complex to DNA for transcriptional repression. It has also been shown to interact with the histone deacetylase containing corepressor transducin-like enhancer of split (TLE) and may play a role in bridging the mSin3A and TLE transcriptional networks. Alternate names for PF1 include PHF12, PHD finger protein 12, and KIAA1523.

Alternate Names

FLJ34122, KIAA1523MGC131914, Pf1, PHD factor 1, PHD finger protein 12, PHD zinc finger transcription factor

Gene Symbol

PHF12

Additional PF1 Products

Product Documents for PF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PF1 Antibody - BSA Free and earn rewards!

Have you used PF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies