PGLYRP4/PGRP-I beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09527

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PGLYRP4/PGRP-I beta Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PGLYRP4/PGRP-I beta (NP_065126). Peptide sequence LGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PGLYRP4/PGRP-I beta Antibody - BSA Free

Western Blot: PGLYRP4/PGRP-I beta Antibody [NBP3-09527]

Western Blot: PGLYRP4/PGRP-I beta Antibody [NBP3-09527]

Western Blot: PGLYRP4/PGRP-I beta Antibody [NBP3-09527] - Western blot analysis of PGLYRP4/PGRP-I beta in 293T Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for PGLYRP4/PGRP-I beta Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PGLYRP4/PGRP-I beta

The primary immune recognition is based on structures common among invading pathogens. Bacterial surface molecules, such as lipopolysaccharide (LPS) and peptidoglycan (PGN), are known to elicit immune reactions ranging from cytokine release to fever. Recently, a family of proteins called peptidoglycan recognition protein (PGRP) has been identified in mouse and human that binds to peptidoglycans expressed on Gram-positive bacteria. Peptidoglycan (PGN) is an essential cell wall component of virtually all bacteria (1,2) and, thus, it is an excellent target for recognition by the eukaryotic innate immune system. The PGRPs (PGRP-L, PGRP-S, PGRP-I alpha, and PGRP-I beta) define a new family of human pattern recognition molecules (3). PGRP-L is primarily expressed in the liver. Although liver is not considered a primary immune organ, liver participates in host defenses by producing acute phase proteins (by hepatocytes) in response to infections and by clearing microorganisms from blood (4-5).

Long Name

Peptidoglycan Recognition Protein Intermediate, Beta/Peptidoglycan Recognition Protein 4

Alternate Names

Pglyrp-1 beta, PGRP-I beta, PGRPI beta

Gene Symbol

PGLYRP4

Additional PGLYRP4/PGRP-I beta Products

Product Documents for PGLYRP4/PGRP-I beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PGLYRP4/PGRP-I beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Host Defense/Innate Immunity

Customer Reviews for PGLYRP4/PGRP-I beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PGLYRP4/PGRP-I beta Antibody - BSA Free and earn rewards!

Have you used PGLYRP4/PGRP-I beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies