PHACTR3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09933

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PHACTR3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for Anti-PHACTR3 antibody is: synthetic peptide directed towards the middle region of Human PHAR3. Peptide sequence SPHLTTVHRPLPPSRVIEELHRALATKHRQDSFQGRESKGSPKKRLDVRL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PHACTR3 Antibody - BSA Free

Western Blot: PHACTR3 Antibody [NBP3-09933]

Western Blot: PHACTR3 Antibody [NBP3-09933]

Western Blot: PHACTR3 Antibody [NBP3-09933] - Western blot analysis of PHACTR3 in Human 786-0 Whole Cell. Antibody dilution at 1 ug/mL

Applications for PHACTR3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PHACTR3

PHACTR3 is encoded by this gene is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1. Alternative splicing at this locus results in several transcript variants encoding different isoforms. [provided by RefSeq]

Alternate Names

C20orf101, chromosome 20 open reading frame 101, H17739, MGC117178, phosphatase and actin regulator 3, scaffold-associated PP1 inhibiting protein, Scaffold-associated PP1-inhibiting protein, SCAPIN1, SCAPININ

Gene Symbol

PHACTR3

Additional PHACTR3 Products

Product Documents for PHACTR3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PHACTR3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PHACTR3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PHACTR3 Antibody - BSA Free and earn rewards!

Have you used PHACTR3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies